Protein Info for CA264_13550 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 23 to 51 (29 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 103 to 129 (27 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 378 to 402 (25 residues), see Phobius details amino acids 422 to 440 (19 residues), see Phobius details amino acids 447 to 465 (19 residues), see Phobius details PF18940: DUF5687" amino acids 9 to 490 (482 residues), 520.3 bits, see alignment E=3.8e-160

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU13 at UniProt or InterPro

Protein Sequence (491 amino acids)

>CA264_13550 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MITTLLSHQWKAYYRSSVFQKSLALNIILGLLILYFGAIFLIIGIGMPVLLAELFPGQNP
VDVFNGMLLFYFLIDLFLRFVLQELPVLAVQPYLHLPVRKGKLVHFVLLKSLPSMFNLIF
LLILVPFMYATVVPAYGAGAALAWLFAFLMLTFFNNFVLIYFKRQLSVKPLLTLLFGLAV
AGLMVLDYVGAFSLLAVSRAVFGAVLERPWLAVVPVLLVAAAYALNFQYLKNHTYPEELA
IRKTTRAEGKGIAFLRRFGEIGKLIELEIKLIWRHKRSKSLLTMSLFFLFYGLIFYRNES
YLDSFVVLIFVGIIITGMPMFNYGQFVPSWQSGHFDAILTRRISPYQFYAAKLWIFVSVV
TLAYLLTLPYGFFGYKIILVNTAALLFNIGVNTFIIFFFSVYNTNRLDLSKGSAFSWQGV
GASRFVMMLPMMLLPVLIYLPFKFMGVPDLGVVAIGLLGLAGFAFQKQMLHWTANWFLKH
KYKLASGFRQD