Protein Info for CA264_13510 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13646: HEAT_2" amino acids 59 to 143 (85 residues), 52 bits, see alignment E=1.8e-17 amino acids 92 to 157 (66 residues), 31.5 bits, see alignment E=4.5e-11 amino acids 198 to 275 (78 residues), 33.1 bits, see alignment E=1.4e-11 amino acids 255 to 338 (84 residues), 28.9 bits, see alignment E=3e-10 PF03130: HEAT_PBS" amino acids 72 to 97 (26 residues), 14.3 bits, see alignment (E = 1.3e-05) amino acids 102 to 127 (26 residues), 18.3 bits, see alignment (E = 6.4e-07) PF02985: HEAT" amino acids 88 to 115 (28 residues), 21.2 bits, see alignment (E = 6.3e-08) PF00160: Pro_isomerase" amino acids 520 to 647 (128 residues), 125.3 bits, see alignment E=7.1e-40

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTX3 at UniProt or InterPro

Protein Sequence (666 amino acids)

>CA264_13510 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKQRMNLRYSWLLALGTLASCQYLPLQRSTTPSEPLVNKFGDASLQRIYTLQDERKTSEL
LPFLSDPNTAHRAQAALAFGSVQDTVALPALQALLSDSAVAVREASAYALGQIGHHQAEE
AIIRSLATEQRPEVQAELLEALGKVASTKGADFLAKYSAPNPTALTGQAWGLYRAGLRQQ
YTPQGVETATGLMAARHPYEARLAAAHFLARTPKLDLTQYRQQLLNTATSDQSADVRMAA
AQALNKVRAVDKAQFLSNIAQSDPDYRVRLNAVRAMAGLEFEEIKPAILAALQDQNINTA
VATSEFLLSNRSGADPQVLLQVLPNLLDARVRSNVIWVILNNSQPQNRPYLNQRYKQQYQ
HARTPYDKAHLLKALSGDYKNYAFIAQEMFGAEQPVIATTAMDALILMRQQPDFPRSMEG
AFADIFKRAVGSGDVALVGMAAAAIRDPKLNLRSQYSTYDFLAQAQQKLQLPREMETNIE
LQKTIDYLNGKQESETPQNPFTHPIDWALVKTIPVDQQVLLRTDKGNVTLQLFVEDAPGT
VANFVQLSQQDFFDNLYFHRVVPNFVVQGGDKRGDGWGSSDYSIRSEFAPLHFLEGYLGI
ASAGKDTESNQWFITHSPTPHLDGRYTIFAKVVDGMDVVHRLEVGDKILDVQLAEPLPPV
TSAAHK