Protein Info for CA264_13405 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 5 to 263 (259 residues), 33.2 bits, see alignment E=7.5e-12 PF01370: Epimerase" amino acids 6 to 232 (227 residues), 169.2 bits, see alignment E=2.6e-53 PF16363: GDP_Man_Dehyd" amino acids 7 to 304 (298 residues), 170.6 bits, see alignment E=1.6e-53 PF01073: 3Beta_HSD" amino acids 7 to 223 (217 residues), 40.2 bits, see alignment E=5.6e-14

Best Hits

Swiss-Prot: 52% identical to UXS6_ARATH: UDP-glucuronic acid decarboxylase 6 (UXS6) from Arabidopsis thaliana

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 83% identity to lby:Lbys_0097)

MetaCyc: 53% identical to UDP-xylose synthase 1 subunit (Sinorhizobium meliloti 1021)
UDP-glucuronate decarboxylase. [EC: 4.1.1.35]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.1.1.35 or 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU42 at UniProt or InterPro

Protein Sequence (322 amino acids)

>CA264_13405 NAD-dependent dehydratase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSRKRVLITGGAGFLGSHLCDRFINEGYHVVAMDNLITGNLENIEHLFKLEQFEFYHHDV
SKFVHVPGHLDYILHFASPASPIDYLKIPIQTLKVGSLGTHNLLGLAKAKGARMLIASTS
EVYGDPLVHPQQEDYWGNVNPVGPRGCYDEAKRFQEAMTMAYHMHHGLETRIVRIFNTYG
PRMRLDDGRVLPAFLSQALRGEPLSIFGDGSQTRSFCYVDDLVEGIYRLLLSDYHMPVNV
GNPSEITIREFAEEICRLTGVELKVDYQPLPKDDPQKRQPDITLAKQVLGWEPQVDRAEG
LKRTLEFFKEKILSNTEQPAAV