Protein Info for CA264_13385 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypoxanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01203: hypoxanthine phosphoribosyltransferase
  • amino acids 17 to 178 (162 residues), 166.6 bits, E=2.2e-53
• PF00156: Pribosyltran
  • amino acids 21 to 165 (145 residues), 102.4 bits, E=7.9e-34

Best Hits

Swiss-Prot: 42% identical to HPRT_MYCLE: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Mycobacterium leprae (strain TN)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 55% identity to bsa:Bacsa_1856)

MetaCyc: 42% identical to hypoxanthine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• adenine and adenosine salvage III (3/4 steps found)
• adenine salvage (2/3 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)
• guanine and guanosine salvage II (1/2 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See A0A1X9YTY1 at UniProt or InterPro

Protein Sequence (180 amino acids)

>CA264_13385 hypoxanthine phosphoribosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEPRTVKIHDCEFSTYIFEEEIIARINILAEQIDEDYADKQPLFLAVLNGSFMFVSDLLK
RVSVPCEISFIRLKSYQDMHSTGKVKELLGLTEDIRGRHVVVLEDIVDTGHTVHGLLQQL
KEHNPASVEIATLLMKPECLQHQIEVKYVARSIPNDFVVGYGLDYNGLGRNLRDIYKIVS