Protein Info for CA264_13380 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 4 to 141 (138 residues), 32.6 bits, E=1.7e-11
• PF00406: ADK
  • amino acids 6 to 165 (160 residues), 179.8 bits, E=5.8e-57
• PF13207: AAA_17
  • amino acids 7 to 142 (136 residues), 114.3 bits, E=8.2e-37

Best Hits

Swiss-Prot: 58% identical to KAD_FLAJ1: Adenylate kinase (adk) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 73% identity to sli:Slin_5094)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• purine deoxyribonucleosides salvage (6/6 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

See A0A1X9YTW6 at UniProt or InterPro

Protein Sequence (198 amino acids)

>CA264_13380 adenylate kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLNIVLFGPPGAGKGTQSQNLIDKYNLIHLSTGDLLRSEIAAGTALGLEAKKLMDNGLLV
PDEVVIGMIENKVKEHRHAPGFIFDGFPRTVPQAQGLDKLLQDNGTEISCMIALRVDDEE
LTKRLLLRGKTSGRPDDQNEELIRKRVQEYNTKTAPVADYYAGQGKFYAVDGIGEIEDIF
KALCQQVDAVKEKQDEKK