Protein Info for CA264_13375 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: GTPase Obg

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR02729: Obg family GTPase CgtA" amino acids 6 to 328 (323 residues), 417.5 bits, see alignment E=1.7e-129 PF01018: GTP1_OBG" amino acids 7 to 161 (155 residues), 188.1 bits, see alignment E=1.2e-59 PF01926: MMR_HSR1" amino acids 164 to 284 (121 residues), 81.9 bits, see alignment E=5.7e-27 PF02421: FeoB_N" amino acids 165 to 323 (159 residues), 39.4 bits, see alignment E=6.8e-14

Best Hits

Swiss-Prot: 71% identical to OBG_CYTH3: GTPase Obg (obg) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03979, GTP-binding protein (inferred from 76% identity to shg:Sph21_0075)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTX9 at UniProt or InterPro

Protein Sequence (330 amino acids)

>CA264_13375 GTPase Obg (Pontibacter actiniarum KMM 6156, DSM 19842)
MASSNFIDYVKICSRSGHGGGGSAHLHRDKLTAKGGPDGGDGGRGGHIILRGNAQLWTLL
HLQYRKHIIAENGQNGGPNHSFGAQGKDEVLEVPLGTIARNVETGEVMCEITEDGQEIIL
TPGGRGGLGNAHFKSPTNQTPRYAQPGEPGIEEWVVLELKLLADVGLVGFPNAGKSTLLS
VVSAAKPKIANYAFTTLEPNLGVVAYRDYKSFVMADIPGIIEGASEGRGLGLRFLRHIER
NSMLLFMVACESADIAEEYQVLLNELRTFNPELLDKKRILAITKSDMLDEELEEEMRKTL
PEELPAVFISSITGKNITQLKDMIWEALNS