Protein Info for CA264_13370 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: nucleotide exchange factor GrpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF01025: GrpE" amino acids 26 to 186 (161 residues), 135.2 bits, see alignment E=8.9e-44

Best Hits

Swiss-Prot: 44% identical to GRPE_BACTN: Protein GrpE (grpE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: None (inferred from 52% identity to lan:Lacal_0256)

Predicted SEED Role

"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU67 at UniProt or InterPro

Protein Sequence (188 amino acids)

>CA264_13370 nucleotide exchange factor GrpE (Pontibacter actiniarum KMM 6156, DSM 19842)
MSDKNIKKEQEQEELQEKTANAATEEEQNEAAGDTAAETQEDTTAIELAEMKDKFVRLMA
EFENFRRRTAKERLELAKTASQDVMSDLLPVLDDMERARQSIEAKVDPDAILQGLELVFH
KLKHVTQQKGLKPMETKAGDEFDSELHEAVTQIPAPSDELKGKIVDVIEKGYTLNEKVIR
FAKVIIGA