Protein Info for CA264_13355 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 19 to 424 (406 residues), 202 bits, see alignment E=7.4e-64

Best Hits

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU37 at UniProt or InterPro

Protein Sequence (451 amino acids)

>CA264_13355 ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MSKVWLIIQREYLSRVRKKSFIIMTLLTPLLLATFMVLPGLLISMSDETETVMVLDKSGL
FEGKLQNKKDLNFIPLAGTLDQAKTVYQETDNTALLYIPEMSLSNPEGFVVYGKKNISIQ
TQVRLENMLEKEIESQRYLASGLDRETLDKIKANVDLTAINLSDQGEKDNNAIITSIAGV
VGAVVIYFFIFLYGVQIMRGVIEEKTSRIVEVMISSVKPFQLMMGKIIGIAAVGLTQFLL
WIVLSFVAVTGVSAAFGIDAAPSPAAQYAAGQVAAQGEDVEEGGATVDNPAEKDEFASTI
RDVKQSLANLNVGLIFVCFLFYFLGGYLLYGSLFGAIGAAVDNETDTQQFMMPITIPLVI
SFIMSYSVVLKNPDGPVAFWMSIIPLTSPIVMMVRVPFGVPAWELLLSMGLLVAGFIFTT
WIASRIYRVGILMYGKKVNYKELSKWLFYRV