Protein Info for CA264_13315 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR03999: N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA" amino acids 1 to 371 (371 residues), 571.2 bits, see alignment E=4.6e-176 PF13439: Glyco_transf_4" amino acids 11 to 180 (170 residues), 100.6 bits, see alignment E=3.7e-32 PF13579: Glyco_trans_4_4" amino acids 12 to 174 (163 residues), 56.2 bits, see alignment E=1.8e-18 PF13477: Glyco_trans_4_2" amino acids 16 to 151 (136 residues), 48.5 bits, see alignment E=3.9e-16 PF00534: Glycos_transf_1" amino acids 186 to 344 (159 residues), 126.2 bits, see alignment E=3.6e-40 PF13692: Glyco_trans_1_4" amino acids 199 to 336 (138 residues), 103.2 bits, see alignment E=5.3e-33 PF20706: GT4-conflict" amino acids 211 to 308 (98 residues), 41.4 bits, see alignment E=3.3e-14

Best Hits

Swiss-Prot: 51% identical to BSHA_BACAN: N-acetyl-alpha-D-glucosaminyl L-malate synthase (bshA) from Bacillus anthracis

KEGG orthology group: None (inferred from 75% identity to mtt:Ftrac_3311)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU58 at UniProt or InterPro

Protein Sequence (378 amino acids)

>CA264_13315 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA (Pontibacter actiniarum KMM 6156, DSM 19842)
MRIGIVCYPTFGGSGVVATELGKALALKGHNVHFITYSQPARLDMFSENLFYHEVYIPSY
PLFQYPPYELALASKMVDIVRFEKLDVLHVHYAIPHASAAYMAKQILRTKGINIPIITTL
HGTDITLVGKDASFEPVVTFSINQSDGVTAVSDSLRAETYDYFQIEKDIEVIPNFINLEK
FKRQKKEHFRMAIAPNNEKLLVHTSNFRGVKRVEDVIRIFAKVRQKVSSKLLMVGDGPER
PKMEKLCRELQICQDVRFLGKLEAVEEVLSIADLFLMPSEKESFGLAALEAMACEVPVIS
SNAGGIPELNINGETGFVSPVGAVDEMVENALYILDEEHLPHFKANALKRAHDFDIEKIV
PLYEKLYQRTINEQLALL