Protein Info for CA264_13305 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 TIGR00585: DNA mismatch repair protein MutL" amino acids 5 to 306 (302 residues), 300.8 bits, see alignment E=7.8e-94 PF02518: HATPase_c" amino acids 24 to 81 (58 residues), 33.2 bits, see alignment 1.2e-11 PF13589: HATPase_c_3" amino acids 26 to 131 (106 residues), 42.2 bits, see alignment E=1.6e-14 PF01119: DNA_mis_repair" amino acids 210 to 326 (117 residues), 122.8 bits, see alignment E=1.2e-39 PF08676: MutL_C" amino acids 438 to 573 (136 residues), 121.4 bits, see alignment E=5.3e-39

Best Hits

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU09 at UniProt or InterPro

Protein Sequence (620 amino acids)

>CA264_13305 DNA mismatch repair protein MutL (Pontibacter actiniarum KMM 6156, DSM 19842)
MPDIIHLLPDFLANQIAAGEVVQRPASVVKELLENAIDAQATSVQLIVKEAGKQLVQVVD
NGIGMSETDARMCFERHATSKIRTTEDLFQIRTMGFRGEAMASIGAVAQVELKTRPQGAD
TGTKMLIEGSEVVVQEPVVTPEGTSIAVKNLFYNVPARRNFLKSNAVEMRHILEEFQRVA
LAYPEVAFTLHHNEMEVFNLPATKLSQRIVSIFGSTYKNQMAYCEEDTGFLVVKGYVGKP
EHAKKARGEQFFFVNNRFVKSGYLNHAVMTAFEGLVAKDNHPFYVLFIEIDPEKIDINVH
PTKTEIKFEDEKTVYAIVHAAVKRALGAYNIAPSLDFEQDVNYAPLQPIRLQGGFNSEFE
PEGKPRSSSGGGSPFPGFTPPATTTKRATSRGWEPLYEPLKEVDQEERTSTATSGMGLLD
DAFAAPDAAPASTKKAIQIHQKYLLVQVKSGVMIIDQQAAQERILYEKYNASLQKKTGAS
QALLFPQTVELSAADAVLIKELAAEFKDMGFQFEDFGGNTIILNGIPADVHAADEKELLE
ELIEQYKNNSATLKLDKSENLARAMAKRLASRSLARMSDLEMNSLVDKLFACQVPNYTPG
GQKTLVIMELGQLHELFLKG