Protein Info for CA264_13300 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details PF01694: Rhomboid" amino acids 42 to 102 (61 residues), 62.5 bits, see alignment E=5.1e-21 amino acids 165 to 252 (88 residues), 44.3 bits, see alignment E=2.1e-15 PF08551: DUF1751" amino acids 43 to 99 (57 residues), 31.9 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: None (inferred from 51% identity to sli:Slin_5568)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU23 at UniProt or InterPro

Protein Sequence (259 amino acids)

>CA264_13300 rhomboid family intramembrane serine protease (Pontibacter actiniarum KMM 6156, DSM 19842)
MFNITPMVRNLLIINVVVFLLQLSGLISVENFALYYFGSDMFQPVQLFTHMFMHGGWAHL
FSNMFSLFIFGPLLERFWGPQRFLAFYLITGLGASLLYSGVRAYELNGLEEETATYMLDP
EPMKFYNYMEEHYSGRYNTEFAVEFRRNPDNPTYVEESKEAVRYVYSQVFNSPMLGASGA
VFGILMAFGLLFPNLELMLLFLPIPIKAKYFVLFYGAFELYSGFNRVPGDNVAHFAHLGG
MLFAYILVRMWQRNDYSNY