Protein Info for CA264_13295 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 195 to 212 (18 residues), see Phobius details PF08551: DUF1751" amino acids 62 to 146 (85 residues), 25.3 bits, see alignment E=2.9e-09 PF01694: Rhomboid" amino acids 67 to 211 (145 residues), 77.2 bits, see alignment E=2.2e-25 PF20216: DUF6576" amino acids 268 to 301 (34 residues), 43.2 bits, see alignment 5.2e-15

Best Hits

KEGG orthology group: None (inferred from 47% identity to sli:Slin_5567)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTT5 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CA264_13295 rhomboid family intramembrane serine protease (Pontibacter actiniarum KMM 6156, DSM 19842)
MSIINDIKSAFRQPNNTLKQLILINVIVFVVLIITRTILVLTSGSWVYNIIMRFLALNSD
PLVFITRPWTLITYFFTHEGFLHIIFNMLNLYWFGQLLREYLGDRKLLSLYVLGGVAGGA
LYMLSYNFVPYFADRAAFSFMIGASASVLAIVVGAATLLPNFAFNLILIGPVKIKYIAAF
LVLLSISGAVGDNAGGNIAHIGGALIGWIFIKQLQRGNDMGRPVLAVTDFFGNLFKRKPK
LKITHRRFTGGSAKPNGSRASSGPGTPSQNEIDRILDKISSSGYESLSKEEKQKLFQASQ
KE