Protein Info for CA264_13260 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 1 to 206 (206 residues), 116.1 bits, see alignment E=9e-38 PF13525: YfiO" amino acids 22 to 195 (174 residues), 70.5 bits, see alignment E=3.5e-23 amino acids 166 to 255 (90 residues), 35.1 bits, see alignment E=2.5e-12 PF13432: TPR_16" amino acids 27 to 76 (50 residues), 16.6 bits, see alignment 1.8e-06 amino acids 161 to 236 (76 residues), 16.8 bits, see alignment E=1.7e-06 PF13174: TPR_6" amino acids 62 to 93 (32 residues), 13.3 bits, see alignment 2.2e-05 amino acids 98 to 138 (41 residues), 18.4 bits, see alignment 5.4e-07 amino acids 218 to 236 (19 residues), 14.5 bits, see alignment (E = 9.4e-06)

Best Hits

KEGG orthology group: K05807, putative lipoprotein (inferred from 40% identity to sli:Slin_1307)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY70 at UniProt or InterPro

Protein Sequence (264 amino acids)

>CA264_13260 outer membrane protein assembly factor BamD (Pontibacter actiniarum KMM 6156, DSM 19842)
MFCLLLLATGCSNFQKLLKSNDVSKKYQAALEYYEQEEYYRASQLLDQVTDLMAGTEEAE
KAQFYRAKSHYMQGNYILSDAYFRSFFTTYPRSPLAEEAMFMQAQSLYQQSPSYEEDQTP
TVTAIEAYEEFLVRYPNSEFAPQVNKTIEELYLKLDKKDFNQARLYYQLRYWRSAAVALN
NFLQEHASSPYAEEASFLRLDAQYRFALESVPDKQEERFDQAVDYFQAFVDMYPDSKYKR
EAERVYEAVQSSLASLRKSNQQNS