Protein Info for CA264_13200 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: lysine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 TIGR00499: lysine--tRNA ligase" amino acids 4 to 505 (502 residues), 610.7 bits, see alignment E=9.5e-188 PF01336: tRNA_anti-codon" amino acids 53 to 136 (84 residues), 48.9 bits, see alignment E=7.5e-17 PF00152: tRNA-synt_2" amino acids 165 to 502 (338 residues), 316.8 bits, see alignment E=2.3e-98

Best Hits

Swiss-Prot: 63% identical to SYK_BACFN: Lysine--tRNA ligase (lysS) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K04567, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 81% identity to mtt:Ftrac_1255)

Predicted SEED Role

"Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)" (EC 6.1.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU32 at UniProt or InterPro

Protein Sequence (514 amino acids)

>CA264_13200 lysine--tRNA ligase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQLSEQELRRRHEREELEKMGINPYPSETFDVTATAKEIKENFDKEKNNYQEVSLAGRLM
SRRIMGKASFAELMDSTGRIQIYVSRDDIAPGENKDLYNTVFKKMLDIGDFIGIKGYAFV
TQVGEISVHVTELKVLTKSLRPLPIVKREVDENGVEHVYDAFSDPELRYRQRYVDLVVNP
HVRETFRKRTQLVNSMRQFLGGKGYLEVETPILQPLYGGAAARPFKTHHNTLDMTLYLRI
ANELYLKRLIVGGFDGVFEFAKDFRNEGMSRFHNPEFTQVELYVAYKDYNWMMDLVEEMV
EKVAIDLHGTTEVKVGDNVINFQRPWKRFTMFEAIKHFTKIDISEMEEPELRQTAEKLGI
HVDPTMAKGKLIDEIFGETCEPYLIQPTFITDYPVEMSPLAKKHRDKPGLVERFEAICNG
KEICNAFSELNDPIDQRARFEEQLELGKRGDTEAMVLDEDFLRALEYGMPPTAGLGIGID
RLSMIMTNSHSIQDVLFFPQMKPEKQDKKEEEKK