Protein Info for CA264_13090 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptidase M42

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF05343: Peptidase_M42" amino acids 46 to 338 (293 residues), 255.1 bits, see alignment E=1.1e-79 PF04389: Peptidase_M28" amino acids 150 to 329 (180 residues), 26.1 bits, see alignment E=9.8e-10 PF01546: Peptidase_M20" amino acids 170 to 344 (175 residues), 28.2 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: K01269, aminopeptidase [EC: 3.4.11.-] (inferred from 77% identity to chu:CHU_0315)

Predicted SEED Role

"Endoglucanase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YU16 at UniProt or InterPro

Protein Sequence (356 amino acids)

>CA264_13090 peptidase M42 (Pontibacter actiniarum KMM 6156, DSM 19842)
MRQESFDFLQKYLNNSSPTGFEVEGQKLWLEYIKPYIDEYFVDTYGTVVGVVNPQAEYKV
VIEAHADEISWFVNYITPEGYIYLKRNGGSDALIAPSKRVNIHTSKGIVKAVFGWPAIHV
RKVENDKAPTLDTVFLDCGASNREEVEAMGVHVGSVTTFEDEFMVLNDRYYVGRALDNRI
GGFMIAEVARMLKENGNQLPFGLYIVNSVQEEIGLRGAEMIAHRIKPDVAIVTDVTHDTQ
SPMYDKKNSGDIHCGKGPVIAYGPAVQNNVRDLIIRTAQEKEIPFQRSAVSRATGTDTDA
FAYSNAGVASALISLPLKYMHTTVETVHKDDVENVIKMIYETVLKIQDKQDFRYLS