Protein Info for CA264_13080 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: aminodeoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details TIGR00247: conserved hypothetical protein, YceG family" amino acids 27 to 352 (326 residues), 167.3 bits, see alignment E=2.5e-53 PF02618: YceG" amino acids 57 to 346 (290 residues), 266.9 bits, see alignment E=1.2e-83

Best Hits

KEGG orthology group: K07082, UPF0755 protein (inferred from 53% identity to mtt:Ftrac_1707)

Predicted SEED Role

"FIG004453: protein YceG like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTW9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>CA264_13080 aminodeoxychorismate lyase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAKEVNNTTMKRKRKEKSMLKPALAALFLFLFVSFSYYAYQIIYTPNVDTKGQEVYVLIP
TGATYEQAMDSVEASGAIIDRLSLRFMSKLMDYDKLVKPGRYKLENGWGNRQLIGTLRLG
EQTPLNLTFSNVRLRSQLAAKLATELEASEQELDSLLNNQEYLQTLGFDTTNIVSMFIPN
TYEVYWTTTAPDLMKRMKTEYDKFWTPERKAKAEKLGLTQQQVSTLASIVQAETLKNDEK
PRVAGVYLNRLEKGMLLQADPTVVFAVRDFSIRRVLNKHLAYDSPYNTYRYKGLPPGPIN
VPVISSIDAVLNPEDHSYIYFCAKEDFSGYHAFAATEAEHRANARRFHRALNERNILK