Protein Info for CA264_13075 in Pontibacter actiniarum KMM 6156, DSM 19842
Annotation: thioesterase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 59% identity to chu:CHU_1073)Predicted SEED Role
"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Ubiquinone and menaquinone biosynthesis
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.2.-
Use Curated BLAST to search for 3.1.2.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9YTY7 at UniProt or InterPro
Protein Sequence (136 amino acids)
>CA264_13075 thioesterase (Pontibacter actiniarum KMM 6156, DSM 19842) MFESEVQIRVRYAETDQMGYVYHGNYAAYYEVTRTEVFRRLGIAYKELEATGTMMPVLEL KSKFIRPAKYDDLLTIKLLLKSKPHGSRIKFEYEVYNEAETLLTIGETIMVFVDMKTGRP TEVPALIHSKLDEYFN