Protein Info for CA264_13075 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 8 to 123 (116 residues), 90.6 bits, see alignment E=4.6e-30 PF13279: 4HBT_2" amino acids 10 to 127 (118 residues), 62.6 bits, see alignment E=5e-21 PF03061: 4HBT" amino acids 18 to 102 (85 residues), 49 bits, see alignment E=6.4e-17

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 59% identity to chu:CHU_1073)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTY7 at UniProt or InterPro

Protein Sequence (136 amino acids)

>CA264_13075 thioesterase (Pontibacter actiniarum KMM 6156, DSM 19842)
MFESEVQIRVRYAETDQMGYVYHGNYAAYYEVTRTEVFRRLGIAYKELEATGTMMPVLEL
KSKFIRPAKYDDLLTIKLLLKSKPHGSRIKFEYEVYNEAETLLTIGETIMVFVDMKTGRP
TEVPALIHSKLDEYFN