Protein Info for CA264_13065 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DUF4153 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 transmembrane" amino acids 22 to 48 (27 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details PF13687: DUF4153" amino acids 67 to 399 (333 residues), 90.4 bits, see alignment E=7.4e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTU1 at UniProt or InterPro

Protein Sequence (622 amino acids)

>CA264_13065 DUF4153 domain-containing protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MVLHKLQNDGMGLFKQISLQQLWRGAVTTLLAYPLVLLAAVTGTAAGVTLAELSFEQRQR
SLYLEKLMLVSSLGLILFFTLELLVRKYKLALQWRLLLQLAGLLLLGLYFYFLPPELEDR
HWLRYLMLALALHLAASYAMFLNRREENAFWQFNKTLFLRLLTSALYTGVLFLGLVVAVL
AMEELFAVEVDGEFYAQLWLFMVGVFNTWFFLAGVPANVRELEQTHQYPKGLKVFTQFVL
LPLVSLYLLILYAYFGKIIVQWAWPEGWVSVLVLCFSIAGILSLLLIHPIRNEEGNTWMR
TFARWFYRALFPLIILLMLAIWRRVSEYGVTEGRYIVAALALWLLATALYFLFSRQKNIK
FIPVTLSIVAVLAAFGPVNAFRVSEWSQVNRLEALLQENGVLVGGKVQQQHPPVSEEVEQ
EVSSIADYLARRHGFEALQPWFNGSLQDSIAAATDSLDNRWQRNFAARGKVLDLMGLAYT
PGSPRAGETYFYFDSQPPGAGEAVHDIQGYAYALQFHLRNVEGGSERREYTLGGAPLLVS
MDEDATTVYFRFEQETLKLDLLPVVQKLARGQQEQVKPADMTFVVQGEQVQLKVAIEELS
GYRKDRYYIQSVGASVFVQLPE