Protein Info for CA264_13050 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 304 to 321 (18 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details PF02308: MgtC" amino acids 9 to 129 (121 residues), 65.6 bits, see alignment E=5.7e-22 PF13194: DUF4010" amino acids 177 to 386 (210 residues), 202.5 bits, see alignment E=6.8e-64

Best Hits

KEGG orthology group: None (inferred from 52% identity to cpb:Cphamn1_2212)

Predicted SEED Role

"MgtC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTV7 at UniProt or InterPro

Protein Sequence (425 amino acids)

>CA264_13050 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEPELFQILGISLGLGLLVGLQRQHEQSELAGIRTFPLISIFGTISGLLAQDFGGWVIAM
GLASLTALVVAANYMRVKAPHVDVGLTTEAAALLMYAVGAYLVLGDKTVAVVVGATAAVL
LHLKDTLHSFVRRIGEKDLKAIMQFVVISLVILPVLPDQAYGPYDVLNPHNIWLMVVLIV
GIGLLGYFAYKIFGQKSGTLLGGILGGLISSTATTVTYARRTSDDQHTSSKLAAIVIFIA
SAVSVARVIVEVAVVASGTLPTVAPPLAAVFLFMLVLGGGMYLFKGDNADQMPEQGNPAQ
LKTALVFGAIYAAVLLATAFAKDYLGDSGLYIVAVISGLTDVDAITLSTARLMSTDNVGL
DSGWRIILIAALSNLTFKAGLVGVLGSRSVFGKVALLFGAVLAFGMLVLWLWPENFTLLE
DLLAV