Protein Info for CA264_13040 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acriflavin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1035 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 336 to 352 (17 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 385 to 409 (25 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details amino acids 462 to 484 (23 residues), see Phobius details amino acids 523 to 542 (20 residues), see Phobius details amino acids 844 to 862 (19 residues), see Phobius details amino acids 873 to 893 (21 residues), see Phobius details amino acids 899 to 921 (23 residues), see Phobius details amino acids 948 to 968 (21 residues), see Phobius details amino acids 976 to 1002 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 1002 (999 residues), 971.6 bits, see alignment E=4.4e-296 PF03176: MMPL" amino acids 333 to 484 (152 residues), 29.8 bits, see alignment E=3.1e-11 amino acids 812 to 1006 (195 residues), 24.8 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 64% identity to mtt:Ftrac_1898)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTP9 at UniProt or InterPro

Protein Sequence (1035 amino acids)

>CA264_13040 acriflavin resistance protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSLSSISIKRPVLAIVMSITIIVFGFIGITYLGVREYPSVDPPIVNVSTSYTGANAETIE
SEITEPLEESINGISGIRTLTSTSSEGSSNITVEFNLGVDMEAAANDVRDRVSRAQRRLP
EDAEPPTISKADADANPIIMLGVKSDSRSLLELSDIGLNVFKEQLQTIPGVSEVMIWGDK
RYSMRLWMDPDKLAALQVTPLEVQQALTRQNVELPSGSIEGATTELSVRTMGRISTPEEF
NNLIVRQDENRLIRFRDVGYAQLSPENEKTVLRYNGIPMIGVVLVPQPGSNQVEIADEFY
RRLEYIKKDIPEDLELIIGFDNTKYIKASISEVEETIYVAFGLVVVIIFLFLRDWRSTLI
PVVAIPVSLIGSFFIMYVMDFSINVLTLLGIVLAIGLVVDDAIVMLENIYSRIERGEEPM
KAAKKGSNEIYFAIISTTVALAAVFMPVAFLEDTTGRLFREFGIVVAGSVIISSFVSLTL
TPMMSSRLLKRKERPSWFYRKTEPFFTSLTDGYRNSLESFMRVRWVAFILIVLSAGAIWW
QMSTLQSELTPSEDRSGLRIMATGPEGASFEFMDSYMNELTTLVNDSVPGIESIVSMTRG
SNSGFVRLRLVDPAQREVSQQEIVDGLPSLVGKIPGARAFASGDKGLGGGRGSGQPVQFV
VQSQSIDKLRDIIPSFLEAAQQDPTFNFVDVNLKFNKPELRVEIDREKALSLGVDVRDIA
QTMQLGLSGSRFGYFVKGGKQYQILGQVARENRSEPLDLRSLYVKSNTGELIQLDNLIQL
KEENASPQVYRFNRFAAATFSASLAKGKTIGDGIEAMDKIAADVLDETYQTSLTGQSREF
YESSGSLLFAFLLALGLIYLALSAQFESFRDPVIIMFTVPLALAGALLSLWYFDETLNIF
SQIGMIMLVGLVTKNGILLVEFANQRKEEGLDKQAAATDAAVSRFRPILMTSLSTILGTL
PIALALGAGSESRVSMGIAVVGGLIFATGLTLYIIPAIYSYFSSSEANVARMQDEEEQDT
DTHQQEPAREPAFSK