Protein Info for CA264_12960 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptidase M13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF05649: Peptidase_M13_N" amino acids 53 to 432 (380 residues), 459.4 bits, see alignment E=1.3e-141 PF01431: Peptidase_M13" amino acids 484 to 685 (202 residues), 265.2 bits, see alignment E=3.8e-83

Best Hits

KEGG orthology group: K07386, putative endopeptidase [EC: 3.4.24.-] (inferred from 50% identity to sli:Slin_4486)

Predicted SEED Role

"Metallopeptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTW8 at UniProt or InterPro

Protein Sequence (688 amino acids)

>CA264_12960 peptidase M13 (Pontibacter actiniarum KMM 6156, DSM 19842)
MKRTHLLPYSALLAGLLLGGCSTSSQEGTADTTEAGISRGLDLANLDTTVSACQDFYQYA
NGGWLKNNPIPASESRWGSFNELAEKNNAVLRELLTEASSNTTAAKGSASQLIGDFYAVG
MDSVAANQAGINPIKPELDRIGAVKSTDELIKTVADLKTMGVSGFFSMYVSQDDKISTQY
ALQAGQDGLGLPDRDYYLKDDERSKTIRTEYVQHLQRMFQLLGDDAATAQKKAQTVMSIE
TKLATASKARVDLRDPYANYNKMTIQEFANQNPNLKVSQLLTGMGATAAKEIIVGQPAFF
KELNSMLKNVSLEDWKTYTKWHLARTAAPYLSQDFVQENFNFYGKVLSGAKEMQPRWKRV
LRATDSALGEALGQLYVQKTFSPEAKQKAITMVQNLQESFKEHVRDLDWMSEETKQRALQ
KLEAFAVKIGYPDKWEDYKGLDISRDSYAANVMRASQFAFRDNIGKIGQPVDREEWFMSP
PTVNAYYNPTMNEIVFPAGILQPPFFDPNADDAVNYGGMGAVIGHELTHGFDDQGAQYDY
EGNLKNWWSDVDKEQFTSRANAVADQYDQYTVLDNLHVNGKLTLGENIADIGGLNIAYTA
LQKALAEKNPGKIDGLTPEQRFFLAWAQIWRVNMRDEAQNQQILTDPHSPGRFRTNGPVA
NMPQFYEAFGCDQNDPMVRSDEKRIKIW