Protein Info for CA264_12810 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 44 to 69 (26 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 13 to 158 (146 residues), 59.5 bits, see alignment E=1.9e-20 amino acids 227 to 372 (146 residues), 53.3 bits, see alignment E=1.6e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTW4 at UniProt or InterPro

Protein Sequence (377 amino acids)

>CA264_12810 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNNFFQDLSLVWNIVIFVLSGALVWGAGVKLSRYADKVIEKTGISEVFIGTLGLALITSL
PEVATTVSAALADNVSMAVNNLFGSIALQVTVLAVADAYIKNVSLSGSLENPVSRFQGIC
LTFLLAVAAIAILYKDLAVFHVGLWSIVLFILYLALFYVINYFKRMRWWLTEPEERQSIG
KVKAVVSKRVEEIEEEQSREGGDADDETAGKEKKELSEVILSRLGLSFLLAAVCILAGGY
FVANTADAIANKTGVGSSFMGFFFVALTTSLPELSTTVSAAKLKRYRMAFSNIFGTNMLN
VGLVLLADVIYTQGPALDEVGNFAAAGAILGILLTSVYQVGLTIQLRKTYFRLGFDSILV
ILFYIVGAVILFNMRQG