Protein Info for CA264_12800 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 330 to 356 (27 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 436 to 457 (22 residues), see Phobius details amino acids 463 to 481 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 23 to 458 (436 residues), 202.2 bits, see alignment E=1.4e-63 PF00324: AA_permease" amino acids 28 to 462 (435 residues), 118.1 bits, see alignment E=4.5e-38

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 53% identity to sli:Slin_6226)

Predicted SEED Role

"amino acid permease-associated region"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTS0 at UniProt or InterPro

Protein Sequence (489 amino acids)

>CA264_12800 amino acid transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MQDTTQRVQEEEAQSKSGFKREITLFDAIMIVTGGMIGSGIFIVTADIARAVVSPGNMLL
VWVISGFLTMVGAISYGELSSMFPNVGGQYVYLKEAYNKMVAFLYGWTLFLVIQTGVIAA
VGVAFARFTGVLIPWFSEDNVLLQVGDFGFTSVQLLAIVSTIFLTYINSRGVKSGKFIQN
IFGSTKLIALFGLIIFGLWLGVNETAIEANFSDLWGASGAAVAVPTGMALVSAMGIAMVG
ALFSADSWNNIGFSGDEIVNPKRTIVLSMVIGSAIVMGVYLLINMVYLLVLPMHGSPEAT
TALGQGIAYADNDRVAAAVAEVVGGYKATVAIAILIMISTFSCNNGAILSGARVYYAIAK
DGLFFERLGRLNKNGVPAAGLWLQCVWACLLCLSGTYGDLLDYVVFAVMLFYILTIIGVF
ILRVKRPDLPRPYKTFGYPVLPALYVLLSSAICIILLIDKPLYTWPGLLIVALGIPVYYL
FGHKFNRAR