Protein Info for CA264_12760 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:solute symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details amino acids 488 to 510 (23 residues), see Phobius details amino acids 517 to 536 (20 residues), see Phobius details amino acids 542 to 562 (21 residues), see Phobius details PF00474: SSF" amino acids 33 to 301 (269 residues), 97.1 bits, see alignment E=5.5e-32 amino acids 391 to 520 (130 residues), 53.5 bits, see alignment E=9.3e-19

Best Hits

KEGG orthology group: None (inferred from 65% identity to mtt:Ftrac_0141)

Predicted SEED Role

"Sodium iodide symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTL6 at UniProt or InterPro

Protein Sequence (569 amino acids)

>CA264_12760 sodium:solute symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MRPLDWVVLLGTLGFIVSYGVWKTRGSKDIEGYLKGDNTMKWWTIGLSIMATQASAITFL
STPGQAYEDGMRFVQFYFGLPIAMVIISVTVIPIFYRLNVYTAYEFLENRFDLKTRTLAA
LLFLVQRGLAAGITIYAPAIILSTMLGWSLTATNLIIGVLVIFYTVSGGTKAVSVTQKQQ
MAVMMGGMIIAGIMVVSYLPDNVGFGDAVAVAGKMGKMNVVDFSWDWETSWDDRYNFWSG
MTGGLFLALSYFGTDQSQVARYLGGKSVGESRLGLLFNGLLKIPMQFLILFIGVMVFVFY
QFNQPPVFFNEAAKGKVYATEYADELRGLEATYASLFEQKQEAVHGLVSALKAEDAAAIA
TAEAQVDSYTSAGKQVREQVKEVIRKATPDAEVRDTDYVFISFVMKYLPTGLVGLLLAVI
FSAAMSSTASELNALASTTVVDIYKRSVKQDGSPMHYLNASRLFTVGWGLIAILFATYAS
LLDNLIQAVNIIGSIFYGTILGIFLVAFYFKRIRGNAVFFAALLAEAVVLYCYYFTDIAF
LWFNVIGCGCVVIFGFILQAGFGEKKKAV