Protein Info for CA264_12740 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: multidrug ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 264 to 289 (26 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 44 to 312 (269 residues), 186.6 bits, see alignment E=7.6e-59 PF00005: ABC_tran" amino acids 382 to 531 (150 residues), 123 bits, see alignment E=1.4e-39

Best Hits

KEGG orthology group: None (inferred from 62% identity to sli:Slin_5540)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTR1 at UniProt or InterPro

Protein Sequence (606 amino acids)

>CA264_12740 multidrug ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MAKRGFGFSGGEKEKEGRKKISKESFRRGLQIFSYVLPYKYKFIVGLAFLVLSSLTFMAF
PYLVGELFNSSTGSPDGLLQDINMIAMGLFGVILLQGIFSFFRVYFFAQVSENAVADIRR
DLYSKFVQLPISFYEKRRVGEVTSRITTDVAQVQDAMSITLAELFRQTTTLIVGVGIIMW
TSIKLSLFMLATFPVLVALALVFGRRIKTLSKKTQDELANTNVIVEETLQAINTVKAFTN
EMFEVARYRTTLGRAVKTALSAAYYRGAFITFIIIGLFGGIILVIWYGATLVANGDIDGG
SLISFVLYTVFIGASVGGLGEIYGKVQSALGATERILEILQEQEEPTDKGVKALREIPRV
NGDIAYQHVAFSYPTRPDLQVLSNINFSVRAGEKIALVGPSGAGKSTIIQLLMRYYDVSG
GSITVDGRDIRDMNMTMLRGNIGVVPQEVLLFGGTIRENIAYGRPEATEAEVTEAARKAN
AYDFIMSFPEGMDTLVGERGIKLSGGQRQRVAIARAILKNPAILILDEATSALDSESEHL
VQQAMDELMKGRTTIVIAHRLATIRKVDKILVIENGEIVEEGSHEELSHNPEGMYANLLK
LQFELS