Protein Info for CA264_12680 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 166 to 199 (34 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 296 to 312 (17 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 350 to 367 (18 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details PF02366: PMT" amino acids 16 to 241 (226 residues), 60.9 bits, see alignment E=1.4e-20 PF13231: PMT_2" amino acids 66 to 222 (157 residues), 78.4 bits, see alignment E=8e-26

Best Hits

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTP7 at UniProt or InterPro

Protein Sequence (544 amino acids)

>CA264_12680 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MLQSEHLRGGRLLYGLLLVLFLLLLYNLGGWGVIETSEARYAEISREMWQSGQLLHPRLL
GIQHFHKPPVTYQVSALGMELFGPNAFGARFFLQVSLVLQVWLVYLIGKLLFRDGRQALL
AAVVYLTIPAVLLSARNLTTDSFLTTFELAAIWAWLRYKADAKAGWLYLFYFLLALAFLT
KGPVGLIFPALVAIGLAGGFTTAKKRSPAWHHVPAILLFLVIGGSWYAYLMLQDPQFVDY
FLFKHTVQRYANPETFGRSKPWWFYLVLAPALSLPWSAILVVYFKKLKELPAQFKRLFIL
WILVPLVFFSFSGSKLILYILPLFAGQALLTAWLLRALSAEALRKVTRGSLVYFGVLAVA
FLLAPLLPVGIDLPLWALVFPVLMLVGLFIVWRRPLPQLQALLAGALLFTLLLLPYSTHL
MGHNPQLTNGSRPIANVIRQHNLAQRPILVYNKLLPSLAFELNRSIVSLEDGSSDLDREV
QFERDERWREDFLRLEDPADAARLRQLLQQQPVLVVKNTLPKERQWLLQHFSQHVKVGKW
TVFY