Protein Info for CA264_12665 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details PF01569: PAP2" amino acids 102 to 218 (117 residues), 73.6 bits, see alignment E=6.7e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTM0 at UniProt or InterPro

Protein Sequence (228 amino acids)

>CA264_12665 phosphatase PAP2 family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKQRISKTFLRLLALFSLEVLALCAAFFVCLLLFLLMAYLVFSARDNTLDAALFALADRL
ASPGMTLAMKRVSFFASAGFLLVAPPLVVLVLSFFPSWRWLALKLLLVTFSTSVLNQLMK
RYFERPRPAFAMLHQSGLSFPSGHAMIGAAFYGLLIYMVWQKAPVMAWRWTLTLLLTLLV
LLIGFSRIYLKVHYATDVLAGYATGTGWLLVSVTVMRRLEKAYFSRYT