Protein Info for CA264_12610 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00675: Peptidase_M16" amino acids 57 to 191 (135 residues), 88.6 bits, see alignment E=4.2e-29 PF05193: Peptidase_M16_C" amino acids 208 to 377 (170 residues), 86.4 bits, see alignment E=2.2e-28

Best Hits

KEGG orthology group: None (inferred from 41% identity to hoh:Hoch_6664)

Predicted SEED Role

"Protease, insulinase family/protease, insulinase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTM8 at UniProt or InterPro

Protein Sequence (452 amino acids)

>CA264_12610 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MRHRLVALLLLLAFTVTTAMAQQGNQQNNILPYPIHQKQLDNGLNVVTVPYNSPGLAAFY
IVVRAGSREEVEKGKTGFAHFFEHMMFRGTEKYSKEAYGDIMKAMGAAANANTSIDRTVY
HMTGNAEMLDKMFEIEADRFQNLKYSVHDFKTEAGAVKGEYTKNSASPYQQLYEKLVSTA
FKKHTYAHTTMGFFEDVVDMPNQYDYSLTFFDRFYRPEYATIVVVGDVTPERVNNLAQQY
FGDWKRGSYKPDIATEPKQKETRYAHVKQEGFPPYLSLNFKGPAFSDKDKDLPALSILST
ILFAENSDLYRKLVVNEQKARFIGGGPQFSRDPNLISVSASLLDAKDMQYVKDELMKALQ
DAKTKPIDAQKIEETKSRIKYSFAMSMDSPDAIANSLARFIWLSGNPESLNNIYKVYDSI
TAQDLMNAAKKYFVTETMTVGTIAPTEKSPVK