Protein Info for CA264_12605 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: stress protection protein MarC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 2 to 197 (196 residues), 170.6 bits, see alignment E=1.8e-54 PF01914: MarC" amino acids 2 to 202 (201 residues), 180.7 bits, see alignment E=1.2e-57

Best Hits

Swiss-Prot: 36% identical to MARC_ECOL6: UPF0056 inner membrane protein MarC (marC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 41% identity to cja:CJA_0630)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTK1 at UniProt or InterPro

Protein Sequence (206 amino acids)

>CA264_12605 stress protection protein MarC (Pontibacter actiniarum KMM 6156, DSM 19842)
MEIILATLSALFSVVNPFGAMPVFLTLTQDDTAEQRNQQALKACLYMVGILAVFFLAGQY
VLNFFGIRIHDLRIAGGLMIMRAGFELLSPGGSKKKIAPDVVEEGQQKEDISFTPLAMPM
LSGPGAIAVSIGLFTTSLSYLDMVMILIGIILLAVVSYVILRFSHQLTRFMGKSGLAALS
RIMGFIVLSIGVNFIVSALTALFFTE