Protein Info for CA264_12595 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 5-(carboxyamino)imidazole ribonucleotide mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00731: AIRC
  • amino acids 12 to 158 (147 residues), 218.9 bits, E=1e-69
• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 12 to 167 (156 residues), 215.4 bits, E=1.4e-68

Best Hits

Swiss-Prot: 64% identical to PURE_THEMA: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 74% identity to fba:FIC_01753)

MetaCyc: 50% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

See A0A1X9YTI9 at UniProt or InterPro

Protein Sequence (175 amino acids)

>CA264_12595 5-(carboxyamino)imidazole ribonucleotide mutase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAEETTHSQALVGIIMGSQSDLKVMNAAAEILETLGVPYELTVVSAHRTPHRMFEYAENA
RKRGLKVIIAGAGGAAHLPGMVASLTTLPVIGVPVKSSNSIDGWDSVLSILQMPGGIPVA
TVALDGALNAGILAAEIIGTSSAAVADKLEKYKTSLKDKVMRSVEELKRGDRDLD