Protein Info for CA264_12570 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 2-oxoglutarate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF00364: Biotin_lipoyl" amino acids 5 to 77 (73 residues), 69.6 bits, see alignment E=2.4e-23 PF02817: E3_binding" amino acids 129 to 165 (37 residues), 36.6 bits, see alignment 6.5e-13 PF00198: 2-oxoacid_dh" amino acids 222 to 449 (228 residues), 257.3 bits, see alignment E=1.9e-80

Best Hits

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.168

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTF7 at UniProt or InterPro

Protein Sequence (455 amino acids)

>CA264_12570 2-oxoglutarate dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MALVEMVMPKMGESIMEGTVLKWLKNVGDTIEQDESVLEVATDKVDTEVPALQGGVLKEI
LVQEGDVVAVGAPIAVISTNGEDTSSAAAPASAEAPAAVAPEAAPQQTAAASAPSESFAK
LDQPASGRFYSPLVLNIAREEGISMQELEYVPGTGKEGRVSKKDIMTYVENRQNAPQQAA
APQAQAPAQQPQQQAAPAPAAPQAQPQAAPQVKPAASYGGNVELIEMDRMRKMIADRMVD
SKRISPHVTSFVEADVTNIVNWRNKWKNEYKKREGENLTFTPIFIDAIAKAIKDFPMINV
SVDGGTIIRHKDINIGMAVALPSGNLIVPNIKNADQLNLNGLTKKVNDLANRGRMNKLTP
DDLAGGTYTVSNVGSFGNVMGTPIIMQPQVAIMAVGAIKKKPAVIETPEGDLIGVRHFMY
LSHSYDHRVVDGSLGGMFVRRVADYLENFDVNQTI