Protein Info for CA264_12520 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:proton exchanger

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 69 to 94 (26 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 3 to 151 (149 residues), 117.1 bits, see alignment E=3.4e-38 amino acids 176 to 318 (143 residues), 117.3 bits, see alignment E=3e-38 TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 4 to 313 (310 residues), 237.3 bits, see alignment E=1.1e-74

Best Hits

Swiss-Prot: 38% identical to CAXA_ALKAM: Putative antiporter CaxA (caxA) from Alkalimonas amylolytica

KEGG orthology group: K07301, inner membrane protein (inferred from 49% identity to bvu:BVU_1233)

Predicted SEED Role

"Inner membrane protein YrbG, predicted calcium/sodium:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTE8 at UniProt or InterPro

Protein Sequence (321 amino acids)

>CA264_12520 sodium:proton exchanger (Pontibacter actiniarum KMM 6156, DSM 19842)
MLLYILFAIGFVMLIKGADLLVDGSSSIAKRYGLPDMVVGLTIVSFGTSLPELIINILSS
MQGQSELAIGNVFGSNVANLLLILGVTALICPLPIKRNTILTEIPFSLIATLLVGFLANA
TLIDKRPELYISRADGAILLFFFLLFMVYIYNIAKTNKDDELPEEEQTELMPMGKSILYI
LLGVVGLFVGGKWVVDGAVGMAQSMGLSESFIGLTVVAIGTSLPELVTSAMAAYRRNIDI
AVGNVVGSNIFNLLWILGISALINPLPFDVVNNDDIVMMILASTLLIIAMPIGKRNAIDR
WNGVFFLVTYFGYIIYLIMRG