Protein Info for CA264_12515 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: YebC/PmpR family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 2 to 234 (233 residues), 282.9 bits, see alignment E=1.2e-88 PF20772: TACO1_YebC_N" amino acids 4 to 73 (70 residues), 93.7 bits, see alignment E=7.7e-31 PF01709: Transcrip_reg" amino acids 79 to 234 (156 residues), 188.9 bits, see alignment E=5.2e-60

Best Hits

Swiss-Prot: 67% identical to Y3516_CYTH3: Probable transcriptional regulatory protein CHU_3516 (CHU_3516) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: None (inferred from 67% identity to chu:CHU_3516)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTJ0 at UniProt or InterPro

Protein Sequence (235 amino acids)

>CA264_12515 YebC/PmpR family DNA-binding transcriptional regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MGRAFEFRKARKFKRWDKMSKAFTRLGKEIVMAVKESGPNPDTNSRLRTAIQNAKGVNMP
KDRIEAAIKRASSKEEKDYEEVVYEGYAPHGIAVVVECATDNLNRTVANVRMHFSKGGGS
LGKTGSLDFMFDRKGIFKISSEGVDLEELELELIDFGAEDIYEHEGEIIIETPFTEFGNM
QKGLEEKGLEVISAELQRIPTTRTELTEEQEEEVLSMIERFEEDDDVQAVFHNMA