Protein Info for CA264_12480 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF02367: TsaE" amino acids 2 to 125 (124 residues), 131.4 bits, see alignment E=3e-42 TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE" amino acids 12 to 131 (120 residues), 109.4 bits, see alignment E=6.1e-36 PF02492: cobW" amino acids 22 to 62 (41 residues), 21.1 bits, see alignment E=3.2e-08 PF00004: AAA" amino acids 24 to 69 (46 residues), 21.3 bits, see alignment E=4.6e-08

Best Hits

Swiss-Prot: 35% identical to TSAE_TREPA: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) from Treponema pallidum (strain Nichols)

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 56% identity to dfe:Dfer_4961)

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTK8 at UniProt or InterPro

Protein Sequence (138 amino acids)

>CA264_12480 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE (Pontibacter actiniarum KMM 6156, DSM 19842)
MSSLEELPAAASVLIEEAASEPIILFEGPMGAGKTTLIKELCRQLGVQENVSSPTFALVN
EYEGKGGKLIYHFDFYRINDEREALDIGAPEYFESGNLCLIEWPSMIPNLLPEHYLLVEL
QPDAEGKERSLVIRKVEN