Protein Info for CA264_12475 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF05222: AlaDh_PNT_N" amino acids 37 to 170 (134 residues), 129.8 bits, see alignment E=1.2e-41 PF01262: AlaDh_PNT_C" amino acids 176 to 386 (211 residues), 205.9 bits, see alignment E=8e-65

Best Hits

Swiss-Prot: 39% identical to DHA_OCEIH: Alanine dehydrogenase (ald) from Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 54% identity to mtt:Ftrac_3538)

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.1

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTN4 at UniProt or InterPro

Protein Sequence (408 amino acids)

>CA264_12475 alanine dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTEKFAVDLGKLAASQALYPKESMLAVEERRRSLFIGIPKESSFQENRIGLTPDAVKQLT
DQGHRILIEAGAGIPSKYSDNEYSEAGAKIVYATEEVYDADIILKIAPPTYDELDYLRPG
QTLISALHFGNLTSDYINALLRKKINAISFELIRDKSEAKPVVRAMSEIAGSTVMLVAAE
YLSSSNEGKGIILGGITGVAPTKVVILGAGTVAEYAARAALGMGAEVRVFDNHIYKLRRL
KHNVGAQIFTSTLDKAVMNAEIKQADVVIGAFVADEGQITCVVEEGVVAQMNPGSIIIDV
CIDQGGCFETSEITSHSRPIYRKYDIIHYCVPNIPSRVPRTATQALSNIFTPIFTEYSKY
GGINEVLFMNEHYRSGVYIYKGSLTNAHIAKRFGMRYKELGLMIAVRN