Protein Info for CA264_12465 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00106: adh_short" amino acids 6 to 162 (157 residues), 32.8 bits, see alignment E=2.2e-11 PF04321: RmlD_sub_bind" amino acids 7 to 158 (152 residues), 45.6 bits, see alignment E=2.4e-15 PF01370: Epimerase" amino acids 8 to 245 (238 residues), 191.5 bits, see alignment E=7.5e-60 PF02719: Polysacc_synt_2" amino acids 8 to 266 (259 residues), 73.4 bits, see alignment E=8.4e-24 PF05368: NmrA" amino acids 8 to 127 (120 residues), 28.4 bits, see alignment E=4.9e-10 TIGR04180: NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family" amino acids 8 to 303 (296 residues), 499.7 bits, see alignment E=1.1e-154 PF16363: GDP_Man_Dehyd" amino acids 9 to 312 (304 residues), 239.5 bits, see alignment E=3.1e-74 PF01073: 3Beta_HSD" amino acids 9 to 227 (219 residues), 89.5 bits, see alignment E=9.1e-29 PF07993: NAD_binding_4" amino acids 10 to 184 (175 residues), 56.5 bits, see alignment E=1.1e-18 PF13460: NAD_binding_10" amino acids 12 to 180 (169 residues), 51.3 bits, see alignment E=6.2e-17

Best Hits

KEGG orthology group: None (inferred from 75% identity to pmx:PERMA_1630)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTH4 at UniProt or InterPro

Protein Sequence (332 amino acids)

>CA264_12465 NAD-dependent dehydratase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLNNKRVLVTGADGFIGSHLVERLLEEGCKVKAFVYYNSFNSWGWLDTLSKEKLSQIEI
FAGDIRDPNGVRTAMKDIEVVFHLAALIAIPFSYHSPDSYIDTNVKGTLNIVQAAKDLGV
ERVLVTSTSEVYGTAQYIPIDEKHPRQPQSPYSASKIGADCIADSFYRSFNLPLTIVRPF
NTYGPRQSARAVIPTIITQLLQGKTEIKLGDLTPTRDLLFVKDTANGFVEIAKSDSLIGE
DCNIATESEISVGDLAQSLINQINPQARIIQDEVRLRPEKSEVFRLYGANGKIKSNTNWD
LKYTLEEGLAETIEWFRNTENLRQYKADIYNI