Protein Info for CA264_12460 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: aminotransferase DegT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR04181: aminotransferase, LLPSF_NHT_00031 family" amino acids 24 to 382 (359 residues), 548.8 bits, see alignment E=2.4e-169 PF01041: DegT_DnrJ_EryC1" amino acids 34 to 384 (351 residues), 290.4 bits, see alignment E=3.5e-90 PF01212: Beta_elim_lyase" amino acids 55 to 239 (185 residues), 29.4 bits, see alignment E=7.6e-11 PF00155: Aminotran_1_2" amino acids 68 to 198 (131 residues), 19.9 bits, see alignment E=5.5e-08

Best Hits

KEGG orthology group: None (inferred from 60% identity to shg:Sph21_1813)

MetaCyc: 52% identical to UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-idosamine transaminase (Escherichia coli O108)
UDP-2-acetamido-4-amino-2,4,6-trideoxyglucose transaminase. [EC: 2.6.1.34]

Predicted SEED Role

"Bacillosamine/Legionaminic acid biosynthesis aminotransferase PglE; 4-keto-6-deoxy-N-Acetyl-D-hexosaminyl-(Lipid carrier) aminotransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTJ7 at UniProt or InterPro

Protein Sequence (385 amino acids)

>CA264_12460 aminotransferase DegT (Pontibacter actiniarum KMM 6156, DSM 19842)
MTQSSKYSNIIDYIKGLFPNQSFIPLHEPRFVGNERKYVIDAIDSTYVSSVGAYVNRFEE
MMQEITGAKYAVATVNGTAALHMALIVAGVNQGDEVISQDLTFIATANAISYLGASPVFL
DIDRNNLGLSAASLEAFLQENGKKESNATFNRKTGKRIAACVPMHSFGFPCDIDKIAAIC
DEWHIPLVEDAAESLGSYHDSKHTGTTGLVGTFSFNGNKTVTCGGGGAIVTNNEAIAKLA
KHLTTQAKVPHAWEFNHDHIGYNYRMPNLNAALACAQLEQLSTFIENKRELASKYKLFFD
GIEGVEFVTEEPGAKANYWLNVLLLESKEERDAFLTEANSNGVMVRPAWTLMHKLPMFQN
NIYGDVSVSTWVEERLVNIPSSVRL