Protein Info for CA264_12450 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: N-acetylneuraminate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR03569: N-acetylneuraminate synthase" amino acids 4 to 333 (330 residues), 467.3 bits, see alignment E=1.2e-144 PF03102: NeuB" amino acids 24 to 265 (242 residues), 324.8 bits, see alignment E=3.5e-101 PF08666: SAF" amino acids 288 to 341 (54 residues), 24.5 bits, see alignment 3.2e-09

Best Hits

Swiss-Prot: 50% identical to NEUBH_CAMJE: N,N'-diacetyllegionaminic acid synthase (legI) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K01654, N-acetylneuraminate synthase [EC: 2.5.1.56] (inferred from 59% identity to shg:Sph21_1815)

MetaCyc: 50% identical to N,N-diacetyllegionaminate synthase (Campylobacter jejuni jejuni NCTC 11168 = ATCC 700819)
RXN-12238 [EC: 2.5.1.101]

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.56

Use Curated BLAST to search for 2.5.1.101 or 2.5.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTD8 at UniProt or InterPro

Protein Sequence (341 amino acids)

>CA264_12450 N-acetylneuraminate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNKTVIIAEAGVNHNGDIQLAKQLIDVAADAGVDYVKFQTFKADKLVSKTAKQAVYQVKN
QKSQSDDTQYSMLKKLELSEEDHYVLQAYASDKGIKFLSTGFDPESIDFLDQLGIDLFKV
PSGEITNKPYLEQIAKKGKAVVLSTGMATLQEVGDAISVLAKAGLSNEDISVLHCNTEYP
TPMGDVNLKAMLAIKDSFGVKVGYSDHTLGIEVPIAAVALGAVLIEKHYTLDKELPGPDH
KASLSPQELKDMVLAIRNVEQALSGSAEKEPSTSELKNRELIRKSIYYSSALIKGTVVGD
DHLIMMRPATGISPMEVDSVVGKALKCNVEQGQIVNFDDFE