Protein Info for CA264_12425 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: CMP-N-acetylneuraminic acid synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02348: CTP_transf_3
  • amino acids 5 to 183 (179 residues), 97.7 bits, E=4.4e-32

Best Hits

KEGG orthology group: K00983, N-acylneuraminate cytidylyltransferase [EC: 2.7.7.43] (inferred from 59% identity to fbc:FB2170_05775)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

• CMP-N-acetylneuraminate biosynthesis II (bacteria) (3/3 steps found)
• CMP-N-acetylneuraminate biosynthesis I (eukaryotes) (2/5 steps found)
• superpathway of CMP-sialic acids biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.43

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

See A0A1X9YTM5 at UniProt or InterPro

Protein Sequence (227 amino acids)

>CA264_12425 CMP-N-acetylneuraminic acid synthetase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRTLFLIPARGGSKGLPGKNIKSLNGKPLILYTIEAAREVSDAADICVSTDDVEIKNVVE
QYGLKVPFLRPSEIATDFATSEQVVEHALQVYEENGLVYDYIVLLQPTSPLRTGQHLKEA
LRLIDEGTEMIVSVKETDANPYYVLMEEDSEGVLYKSKTGLFHRRQDCPKVYELNGAIYI
IEVKKFKEVGLAQLKKKKYLMDKVSSIDIDDELDFTLAELVITRKGE