Protein Info for CA264_12420 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details PF00005: ABC_tran" amino acids 349 to 500 (152 residues), 101.5 bits, see alignment E=3.3e-33

Best Hits

KEGG orthology group: None (inferred from 52% identity to gfo:GFO_2029)

Predicted SEED Role

"Phospholipid-lipopolysaccharide ABC transporter" in subsystem N-linked Glycosylation in Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY24 at UniProt or InterPro

Protein Sequence (572 amino acids)

>CA264_12420 ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSVALSLLVGVLDGFGLAMFLPLLQMVDGSGAEVSSEEMGKLSFLVEGLRTVGLDISLQT
VLMVMLVFFVLKGVMKFFEGYYKVILQQVFIRQIRFTNIDLLSGYDYKSFVSSDSGKIQN
TLSGEVERVMQAYRSYFSAFQSGILVAVYMFLAFMSNAQFAILVMIGGGLTNFIFSKFYK
KTKIQSKNLTLESHSFQGLLIQKVANFKYLKASGLIRNFGYKLKSSIAHIEEVQRKLGML
ASALVAIREPIVMLVVVAVILIQMKLLGGSLGLIILSLLFFYRALTFLMAVQNHWNTFLS
VSGSLDNMTEFTNDLAVNQEHQGTKSVNSFNQSLRLNGLDFFYNQEQVLKNVSFTISKNE
TIALVGESGSGKTTLMNVLCGLLPVGRGMYEVDGVDRKDINMLSFQKRIGYITQEPVIFN
DTVFNNITFWDEPTEANIQRFENALKLAAIFDFVMELPEKQNAPLGHNGVMVSGGQKQRI
SIARELYKEVDFLFMDEATSALDSETEKSIQENINLLKGKYTIIIIAHRLSTVKDADKIV
YLKNGAIESIGTFDRLRETSSRFNKLVEMNNL