Protein Info for CA264_12375 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF13477: Glyco_trans_4_2" amino acids 52 to 117 (66 residues), 27 bits, see alignment E=1.5e-09 PF13439: Glyco_transf_4" amino acids 53 to 170 (118 residues), 64.5 bits, see alignment E=3.9e-21 PF13579: Glyco_trans_4_4" amino acids 75 to 166 (92 residues), 34.3 bits, see alignment E=9e-12 PF00534: Glycos_transf_1" amino acids 183 to 346 (164 residues), 131.5 bits, see alignment E=7.3e-42 PF13692: Glyco_trans_1_4" amino acids 194 to 332 (139 residues), 101.1 bits, see alignment E=1.9e-32 PF13524: Glyco_trans_1_2" amino acids 271 to 360 (90 residues), 38.7 bits, see alignment E=2.9e-13

Best Hits

KEGG orthology group: K01043, [EC: 2.-.-.-] (inferred from 47% identity to gfo:GFO_2002)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTH5 at UniProt or InterPro

Protein Sequence (372 amino acids)

>CA264_12375 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSQKIKVLHVIKSLGRGGAEMLLPETLKYHNKVEFEFHYIYFLPWKNQMVEAIKNNGGVV
SCFEASNNIQIFQKVPSLVRYIREQGINLVHCHLPWAGIAGRIAAKLTGVPVIYTEHNNF
SRYHSLTKFASRLTISLNQLIIPVSRDAEVALKKFVSPEKIKLILNGVDTGSFRKTSEDA
GFRSKLEIPADNLVVATAAVFREQKRLDNFLKVAEGVCSTNDKVSFIIVGDGPEKEKLKV
LAEPLRSQGKVHFAGLQENVKPYFNMADVYLMTSDFEGLPIALLEAMSMSCAIVSTAVGG
VPEVVENGVSGLLCDAGDVVALEKNVNLLLQDKEKRTTLAANARERVEQRFSMKNMVQKL
EVVYKQYAKYGV