Protein Info for CA264_12365 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: asparagine synthetase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 TIGR01536: asparagine synthase (glutamine-hydrolyzing)" amino acids 2 to 540 (539 residues), 382.8 bits, see alignment E=1.7e-118 PF13522: GATase_6" amino acids 29 to 152 (124 residues), 115.3 bits, see alignment E=4e-37 PF13537: GATase_7" amino acids 44 to 156 (113 residues), 121.1 bits, see alignment E=5.6e-39 PF12481: DUF3700" amino acids 66 to 156 (91 residues), 36 bits, see alignment E=1.1e-12 PF00733: Asn_synthase" amino acids 234 to 605 (372 residues), 266.5 bits, see alignment E=1.1e-82

Best Hits

Predicted SEED Role

"Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)" in subsystem Cyanophycin Metabolism or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 6.3.5.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTL3 at UniProt or InterPro

Protein Sequence (611 amino acids)

>CA264_12365 asparagine synthetase B (Pontibacter actiniarum KMM 6156, DSM 19842)
MCGIFGKVGSLRERDMHVATEMLCHRGPDGQVHKTYAQNVHFFHARLSIVDIEGGTQPMD
DEGLAIIFNGEIYNHQELRTKFGLTGKTRSDTETVLLMYKQLGLDMLSHMDGMFAIALFD
KKQGKVFLLRDRAGKKPLYIGVADDGIYFGSEQNLLQKIMRPSIYLPSIAEYLQTGMVYG
KNTPYKDIYELQPGHRISIDVENLSMSEQQQWWSIEPYYEQVLELQEQEALALLDEKLKI
AVKRRVESSDLEVGCFLSGGIDSGIMAAMASELKPNLRTFTVKFQNEYDESVVAKQVAKY
LNTNHQELEVSYDKLTNDFESIVRAYGEPFMDDSQIPSYYVAREAKKHVTVIINGDGGDE
LFGGYRRYVPFAHSFFRNGVVKGASKAVAPFLPAPASKMNMYNYLYRLVKLSSRNDFEQY
LSASTDVLFDYKRDYKVQPEPSFQTLVARNFSKNISGLRKIMLTDFQGILPYILLKKIDI
SSMQSSLEGRSPFLSKEIMEFAPSLSDNLKIRGGTTKYLLRKLASQYLPAGNDKLPKKGF
EVPIINLVDKDINPLLKDYVNSSDCLYKEVIDPKLVQRLMNGTLNISKDKRAKILFSLLT
MEIWYKNQKQV