Protein Info for CA264_12350 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glycosyltransferase family 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 24 to 171 (148 residues), 49.7 bits, E=1.3e-16
• PF13579: Glyco_trans_4_4
  • amino acids 25 to 171 (147 residues), 66.1 bits, E=1.4e-21
• PF13477: Glyco_trans_4_2
  • amino acids 26 to 144 (119 residues), 34.8 bits, E=5.8e-12
• PF00534: Glycos_transf_1
  • amino acids 195 to 359 (165 residues), 109.7 bits, E=3.5e-35
• PF20706: GT4-conflict
  • amino acids 203 to 321 (119 residues), 26.1 bits, E=1.2e-09
• PF13692: Glyco_trans_1_4
  • amino acids 205 to 345 (141 residues), 93.9 bits, E=3.2e-30

Best Hits

KEGG orthology group: None (inferred from 57% identity to ran:Riean_0748)

Predicted SEED Role

"Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See A0A1X9YTI0 at UniProt or InterPro

Protein Sequence (390 amino acids)

>CA264_12350 glycosyltransferase family 1 protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKLFRITTVPLSLQKLITGQLPYMRSKGFEPLMISAEGPEAEAAKREQESPLVVVPMTR
KVTPLQDLRSLWTFYKLCKKHKPQIIHSHTPKAGIIGMLGGKLAGVPVRLHTVAGLPLME
ATGTKRRVLDAVEKLTYACATKVYPNSTVLKDFILQSGYCGPEKVKVIGNGSSNGINTSF
FSVEALNLDKLQALKHELGINTGDFVFVFIGRLVKDKGIRELVSAFKAVQAKYAQAKLLL
VGPMEQDLDPLPPETLLEIEQNESIIPVGYQNDVRPYLALSQALAFPSYREGFPNVPMQA
GCFELPSIVTNINGCNEIIVEGENGLIIPPKNTQKLQEAMERLLVDENLYAHLQSNARRM
IVERYDQEHFWELLYQEYQEHLRQHELAIP