Protein Info for CA264_12345 in Pontibacter actiniarum KMM 6156, DSM 19842
Annotation: lipid carrier--UDP-N-acetylgalactosaminyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to PGLC_CAMJE: Undecaprenyl phosphate N,N'-diacetylbacillosamine 1-phosphate transferase (pglC) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
KEGG orthology group: None (inferred from 69% identity to ran:Riean_0747)MetaCyc: 59% identical to N,N'-diacetylbacilliosaminyl-1-phosphate transferase (Campylobacter jejuni)
RXN-13269 [EC: 2.7.8.36]
Predicted SEED Role
"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)
MetaCyc Pathways
- protein N-glycosylation (bacterial) (1/7 steps found)
- protein O-glycosylation (Neisseria) (1/8 steps found)
KEGG Metabolic Maps
- Anthocyanin biosynthesis
- Carotenoid biosynthesis - General
- Flavone and flavonol biosynthesis
- Flavonoid biosynthesis
- Fructose and mannose metabolism
- Glycerolipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Glycosphingolipid biosynthesis - globo series
- Glycosphingolipid biosynthesis - lacto and neolacto series
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- High-mannose type N-glycan biosynthesis
- Keratan sulfate biosynthesis
- Lipopolysaccharide biosynthesis
- N-Glycan biosynthesis
- O-Glycan biosynthesis
- O-Mannosyl glycan biosynthesis
- Peptidoglycan biosynthesis
- Sphingolipid metabolism
- Zeatin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.4.1.-
Use Curated BLAST to search for 2.4.1.- or 2.7.8.36
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9YTF9 at UniProt or InterPro
Protein Sequence (205 amino acids)
>CA264_12345 lipid carrier--UDP-N-acetylgalactosaminyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842) MNWLYRNYLKRLVDFILSLTAFIVLLPVFLVVTGLLYMANQGKPFFLQPRPGKDGKIFRV IKYKTMNDQQDAQGNLLPDEVRLTPVGKFVRKTSLDEVPQLLNVIKGDMSLIGPRPLLVE YLPLYNEVQQRRHEVRPGITGWAQVNGRNAISWDQKFKYDVWYVDNISPMLDIKIIFLTI LKIFKSEGISAEGVATMPKFQGNKS