Protein Info for CA264_12325 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details PF00106: adh_short" amino acids 289 to 362 (74 residues), 28.9 bits, see alignment E=3.2e-10 PF04321: RmlD_sub_bind" amino acids 290 to 416 (127 residues), 52.2 bits, see alignment E=1.9e-17 PF02719: Polysacc_synt_2" amino acids 291 to 587 (297 residues), 393 bits, see alignment E=3.2e-121 PF08659: KR" amino acids 291 to 413 (123 residues), 25.4 bits, see alignment E=5e-09 PF01370: Epimerase" amino acids 291 to 517 (227 residues), 86 bits, see alignment E=1.1e-27 PF16363: GDP_Man_Dehyd" amino acids 292 to 415 (124 residues), 64.9 bits, see alignment E=3.6e-21 PF01073: 3Beta_HSD" amino acids 292 to 421 (130 residues), 40.7 bits, see alignment E=6.2e-14 PF07993: NAD_binding_4" amino acids 293 to 453 (161 residues), 27.9 bits, see alignment E=5.3e-10

Best Hits

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTG5 at UniProt or InterPro

Protein Sequence (643 amino acids)

>CA264_12325 polysaccharide biosynthesis protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKILLNKSLPKWIVLLIDQLIMSWSFALSFFIIKQFAFDEIMRGHFLVYIGLFGIISLIT
FYSMRVHTGLIRYSSIYDIYRIFSAVSITSLVYAALIGLWVAPIHHIDSVNIYLVLLISF
FVSSTLLTLVRMGAKALFVFIKRSSPSVRERVLIYGANGYSILLKQALEASGEGRFIICG
FLDDNPNKVDKDIHQKRVYYIDDIERLQRKLQVDKVIIFSEDLKTDNRKLFVERCIEMGI
KVLTVPPTEQWMSGQLSLNQIKDLKIEDLLQRPPIVIENDRICSDLRKKRVLVTGGAGSI
GSEIVRQVLSYDPALVVVCDQAESPLHELQLEMEELYPDAQIAIFIGDITNSDRMYTLFK
EYEPDVVYHAAAYKHVPMMENNPCEAILTNVLGTKNLADLSLTFDVEKFVMISTDKAVNP
TNIMGTSKRIAEIYIQSLNNLHHGKVNGHTHPYTKVVQTRFITTRFGNVLGSNGSVIPRF
RQQIEKGGPVTVTHPDITRYFMTIPEAVQLVLEAGTMGNGGEIFIFDMGEPVKIVDLANK
MIKLAGLIPNVDIPVTFTGLRPGEKLYEELLNEEEQTIPTHHKKIKISKVRHYSYDDVVS
DIDELMKLNKTKDELQVVRKMKQIVPEYISKNSRFEELDFQVN