Protein Info for CA264_12305 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MRP family ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF01883: FeS_assembly_P" amino acids 5 to 75 (71 residues), 65 bits, see alignment E=2.2e-21 PF10609: ParA" amino acids 97 to 346 (250 residues), 329.7 bits, see alignment E=4.5e-102 PF13614: AAA_31" amino acids 99 to 245 (147 residues), 40.5 bits, see alignment E=1.2e-13 PF09140: MipZ" amino acids 100 to 142 (43 residues), 28.9 bits, see alignment 3e-10 PF01656: CbiA" amino acids 101 to 275 (175 residues), 54 bits, see alignment E=7e-18 PF02374: ArsA_ATPase" amino acids 103 to 146 (44 residues), 25.2 bits, see alignment 3.7e-09

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 69% identity to chu:CHU_0926)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTE2 at UniProt or InterPro

Protein Sequence (367 amino acids)

>CA264_12305 MRP family ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MAITKEDILKALSYVEEPDLGKDLVTLNMVEDVQVDGKNVSFTVILTTPACPLKDLIRNA
CVTAIHTMVDKEADVTVNMTSRVTSGRGDTSEVLHGVKNIIAVASGKGGVGKSTVTSNLA
IALAQSGARVGLIDADISGPSIPTMFGVEQERPRMVQGDHGKNYILPVEQHGVKMMSIGF
LTPQDGAVVWRGPMASSALRQFISDVEWGELDYLLLDLPPGTSDIHLTMVQALPVTGAVI
VTTPQKVALADAMKGLQMFRQPQINVPVLGVVENMAYFTPAELPENKYYIFGEGGGKALA
DKYNVALLGQVPIVQSIRESGDNGTPVVMQNDSPASGVFKELAQSVAQQVSLRNATMART
KPVEIKS