Protein Info for CA264_12245 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 79 (25 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details PF12730: ABC2_membrane_4" amino acids 3 to 169 (167 residues), 38.7 bits, see alignment E=5.3e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTG0 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CA264_12245 ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLLRIELCKLLPYRTMWVILGIFVALMLLLLYASSNVSINGQELGNRMYDLPRFWQTLA
YVASFFNLLFGILLIVLVSDEYSFRTLRQQVIDGLTRVELVLAKFYVVLGLGLFATVFLL
LLGLYFGLLHGSQHTLGAVFGQINHLSYYFVQAVGYMTLAMLFGFAIRKSGLAIIAFVAY
AQVVEPLIHFRLPDTVDKYMPVKVFKSLTPMPAQEVLDQLTAPTEMLSLPWAALLSIGYA
GLFCFLSYYLLKVRDL