Protein Info for CA264_12230 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details PF11667: DUF3267" amino acids 72 to 175 (104 residues), 71.9 bits, see alignment E=2.6e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTC1 at UniProt or InterPro

Protein Sequence (194 amino acids)

>CA264_12230 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MDEAQYEQTELTVTAAAANKQALAFVLPILVLYMVPYFLLWPEQFSWQLLEGFVRAHGVA
TLFYPLLMLLVFILGAVVHELLHGLTWAVFCKRGVKAVTYGVHWSYLTPYCHCREVLPLR
PYILGGLMPGLVMGLLPALAGMATGKLLLFLFGLLFTLAASGDLLVLWMLRHARASDLVQ
DHPEKIGCYVYRRK