Protein Info for CA264_12165 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details PF01435: Peptidase_M48" amino acids 127 to 217 (91 residues), 20.4 bits, see alignment E=7.9e-08 PF13699: DUF4157" amino acids 146 to 180 (35 residues), 27.8 bits, see alignment 4.7e-10 PF05569: Peptidase_M56" amino acids 150 to 236 (87 residues), 46.7 bits, see alignment E=5.1e-16 PF03544: TonB_C" amino acids 357 to 434 (78 residues), 64.9 bits, see alignment E=1.6e-21 TIGR01352: TonB family C-terminal domain" amino acids 359 to 435 (77 residues), 41.7 bits, see alignment E=5.7e-15

Best Hits

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YTD6 at UniProt or InterPro

Protein Sequence (436 amino acids)

>CA264_12165 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEALLNYTVKVGIGLLALYLFYFALLRRQNNFAFNRAYLLSAPLIALLLPLVTWPALLAP
EAAVTQTLEAVRLGEVMVTARRPDNAAPGTAFAVSTVLAGLYLAGVLLIVAKLGRQLWQI
RQMKSAATPVPAAVPAQVYQLHTHYPAFAFGSSIFLSKQQAQLSQQEQQQVLAHEMAHVQ
FGHTWDVLFYELLSAVLWFHPALWLLKQELRDVHEYQADAAVVEEHQTQQYTSLLSREAL
LTMGLPVGSHFTRPQVLKRLHMLQRQGQKPSWIRPLLVLPLLGGLAFMLARQQAAALPAA
MQSQPLRTAVKPAVTEAAADEAQPSEETAKDQPYTYVEQMPSFEGGDTALLKFLGTNIRY
PEDAKQAGVEGLVVLSFVVEQDGSLYDFQLVKGVSPSIDAEAMRVVKRMDGKWSPGRQNN
QPVPVRYTIPVRFAIR