Protein Info for CA264_12140 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 327 to 400 (74 residues), 27.7 bits, E=7.3e-10
• PF01370: Epimerase
  • amino acids 327 to 588 (262 residues), 173.1 bits, E=2.7e-54
• PF16363: GDP_Man_Dehyd
  • amino acids 328 to 652 (325 residues), 174.8 bits, E=1.4e-54
• PF02719: Polysacc_synt_2
  • amino acids 328 to 451 (124 residues), 38.7 bits, E=2.9e-13
• PF01073: 3Beta_HSD
  • amino acids 328 to 584 (257 residues), 67.1 bits, E=5.6e-22
• PF08659: KR
  • amino acids 328 to 401 (74 residues), 26.7 bits, E=2e-09
• PF04321: RmlD_sub_bind
  • amino acids 328 to 553 (226 residues), 39.1 bits, E=1.9e-13
• PF07993: NAD_binding_4
  • amino acids 329 to 564 (236 residues), 65 bits, E=2.5e-21

Best Hits

KEGG orthology group: K12454, CDP-paratose 2-epimerase [EC: 5.1.3.10] (inferred from 58% identity to gem:GM21_2537)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• CDP-tyvelose biosynthesis (1/2 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• UDP-sugars interconversion (4/9 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (2/8 steps found)
• stachyose degradation (1/7 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.10 or 5.1.3.2

Sequence Analysis Tools

See A0A1X9YYF5 at UniProt or InterPro

Protein Sequence (686 amino acids)

>CA264_12140 NAD-dependent dehydratase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSKDIAKSKEATLPIVGLVEWFRPGEYEHVKQTLADLKELGVTELRTGVSWADYYSPEGK
GWYDWLIPTLAKEVNVLPCFLYTPPSIAERPRTSSPPKDKKAYADFLDVFIADHGKHFEW
VELWNEPNNTVEYDFTHDYGWHKFAEMVGGAAHWCQKLGKKTLLGGMSPVDPNWLQTMFD
RGVMQYIDAVGIHGFPHVFDQMWDGWEDTINSVREVLDRNGSKAELWITEAGFSTWQHDE
YKQLEEFKLALQADASRLYWYGVKDLDASLPTVAGFHLDDREYYFGLKRADGTSKLLFRL
WAKHGIEKLRELSYIKRTVDASQEPYALITGGAGFVGTNLAKRLLEQGKRVMVFDSLSRD
GVEQNLQWLHDTYGDRLEVYVGDIRDLQTVRHVMKRAEQVFHFAAQVAVTTSLDLPINDF
EINARGIINVLEAIREQDNPPPLVFTSTNKVYGGLEDLKFISNGSRYYPAEAEIKKYGIS
EARHLDFHSPYGCSKGAADQYVIDYARTYNLPMAVFRMSCIYGPHQYGNEDQGWVAHFAI
RAIEGEQVNIYGDGKQVRDILFVEDLVDAFLLAQQHMDQVSGQAFNIGGGPENTVSLLEL
LKTIGRYRGEEIPLKFGEWRPGDQHYYVSDTRKFQKATGWYPKHNVQEGVAKLYQWLCEN
RGYKVPMTLTATLKNDEEPVKKVAVA